SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 390235.PputW619_2705 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390235.PputW619_2705
Domain Number 1 Region: 117-371
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-64
Family D-glucarate dehydratase-like 0.00000000182
Further Details:      
 
Domain Number 2 Region: 5-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.92e-32
Family Enolase N-terminal domain-like 0.00000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390235.PputW619_2705
Sequence length 373
Comment (Pseudomonas putida W619)
Sequence
MTSPTIERLEAIIVDLPTIRPHKLAMHTMQQQTLVVLRLRCSDGVEGIGEATTIGGLAYG
YESPEGIKANIDAHLAPALAGMAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRL
GLPVSELLGGRVRDSLEVAWTLASGDTARDIAEAEHMLEVRRHRVFKLKIGANPLAQDLK
HVVAIKRELGERASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRSGQVRLNQ
RSPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIALYGG
TMLEGSIGTLASAHAFLTVRQLTWGTELFGPLLLTEEIVNEPPQYHDFQLHVPRTPGLGL
TLDEHRLARFARR
Download sequence
Identical sequences B1J8N4
gi|170721878|ref|YP_001749566.1| WP_012314556.1.83615 390235.PputW619_2705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]