SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 390235.PputW619_4465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390235.PputW619_4465
Domain Number 1 Region: 451-562
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000163
Family Anti-sigma factor antagonist SpoIIaa 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390235.PputW619_4465
Sequence length 573
Comment (Pseudomonas putida W619)
Sequence
MHETPPRPGFDWQRWLPGLATLMHYQLAWLPKDIAAGLVLTTMLVPVGIAYAEASGVPGI
YGLYATIVPLLAYALFGPSRILVLGPDSALAAPILAVVVQYAASDPQRAIAIASLMALVA
GAFCVIAGLLRLGFITELLSKPIRYGYMNGIALTVLISQLPKLFGLSIDSQGPLRDLWQL
AQTLIAGQGHWPSFAVGGASLALILLLKPYKRLPGILIAVVLATLAVSLFDLDQMGVKVL
GELPQGLPSFTFPWVTGIDLVEVLLGGIAVALVSFADTSVLSRTYAARLKTPVNPNQEMF
GLGVANLASGLFQGIPISSSSSRTPVAEAAGSKTQLTGIIGAMAVTILLLVAPNLLQYLP
TSALAAVVIAAAMGLFEFADLKRIFRMQQWEFWLSFTCFVGVAVFGAIPGICIAVAISVI
EFLWDGWRPHHAVLGRVDGTRGYHDVQRYPQARRIPGLVLLRWDAPLFFANAEQFQATVL
AAVDESPTPVQRLVIAAEPVTSIDITSADMLAELDRALEARGVELQFAEMKDPVKDKMKR
FELLQHMGETAFHPTVGAAVDAYLQDTGVDWKP
Download sequence
Identical sequences B1JEQ5
390235.PputW619_4465 WP_012316268.1.83615 gi|170723626|ref|YP_001751314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]