SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390235.PputW619_4619 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390235.PputW619_4619
Domain Number 1 Region: 102-239
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.53e-24
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 199-333
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.32e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0097
Further Details:      
 
Domain Number 3 Region: 15-97
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.000000000000523
Family Duplicated SiR/NiR-like domains 1 and 3 0.0098
Further Details:      
 
Domain Number 4 Region: 343-410
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000000089
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390235.PputW619_4619
Sequence length 443
Comment (Pseudomonas putida W619)
Sequence
MPDVPLKQVHTPPVSPRPSACPGLWRIVSALDGGICRIKLPGGLLLADQADAVAAAAERF
AGGVIEATNRGNLQIRGIGDDHAGLIESLLAAGLGPRDAASDDVRNLMLSPLAGHDPLMV
LDVRPLAEHILDMLQGTPRFHQLSAKFAVQLDGGEGLAMLEHPHDLWLSALRLEQRTWLA
FGLAGCPADGQVLGAVPVEQGLALVRAVLERFLDLASPDQARMRQLLENCSVERFIEGLG
LAIRRDDAVLDWRRKAGNSPWLGAVEQLQGMALGVAPPLGRLSADMLRGAARIAREHGDG
SLRLSPWQSLMLTSVAGVSIAPAQRELSALGLLCHSHEPLARMVACTGASGCAKAHGETK
ADAVALAALLPAGAPASVHLSGCPRSCAVAHVAPATLLARSPGRYDLYLRDARLPGFGAL
RAANLTLNEAGAMLDLPTEHLDD
Download sequence
Identical sequences B1J5X3
gi|170723780|ref|YP_001751468.1| WP_012316418.1.83615 390235.PputW619_4619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]