SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 390235.PputW619_4625 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390235.PputW619_4625
Domain Number 1 Region: 82-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000824
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390235.PputW619_4625
Sequence length 145
Comment (Pseudomonas putida W619)
Sequence
MEMQWWIWLVFGIALILLELVLPTFFIIWFGIGAVLVSLISLAAPSLQLDMQVLSWVLFS
SITTALWFKLFRRKQPDVRWTADSVIGEVGLLISSVSQFQKGRVRFQKPILGNEEWICVA
DSDIPSGERVRLVAIEGNTARVIRA
Download sequence
Identical sequences B1J5V0
gi|170723786|ref|YP_001751474.1| 390235.PputW619_4625 WP_012316424.1.83615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]