SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 390333.Ldb1630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390333.Ldb1630
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily GlnB-like 0.000000000000101
Family Prokaryotic signal transducing protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390333.Ldb1630
Sequence length 108
Comment (Lactobacillus delbrueckii bulgaricus)
Sequence
MKLIIAIVQSEYAKRLQSAFVDNNVGATKLASTGGFLREGNTTFLLGVEDEDVDGVLKLI
EEHSQTREETINPGIHPGISFEQPIEPVNITVGGATVFVLPVDQSLHF
Download sequence
Identical sequences A0A061BW49 G6F8Q5 Q1G924
WP_003621973.1.101236 WP_003621973.1.11778 WP_003621973.1.17168 WP_003621973.1.31115 WP_003621973.1.43242 WP_003621973.1.46396 WP_003621973.1.47362 WP_003621973.1.69250 WP_003621973.1.96615 gi|104774436|ref|YP_619416.1| 390333.Ldb1630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]