SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 390874.Tpet_1048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390874.Tpet_1048
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 390874.Tpet_1048
Sequence length 189
Comment (Thermotoga petrophila RKU-1)
Sequence
MAYHAIIIAGFGGQGIMLTGQIIAAAAVIEGKNSTWLPSYGPEMRGGTANCTVIVDEKPI
TSPVVDHPTEVIAMNFPSMMKFGAKLRSGGLLLVNSSVVEQIIERNDIETIEIPANEIAE
EAGSVKAANMVMLGAFLELTRTVSFEAVEEVLREKLSKTKEDLLKIDLIAIKRAGNSSVV
CTTNPLDNP
Download sequence
Identical sequences A5ILJ2
390874.Tpet_1048 gi|148270181|ref|YP_001244641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]