SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391008.Smal_0095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391008.Smal_0095
Domain Number 1 Region: 734-936
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0079
Further Details:      
 
Domain Number 2 Region: 448-635
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000883
Family Pyruvate oxidase and decarboxylase PP module 0.07
Further Details:      
 
Domain Number 3 Region: 34-213
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000241
Family Pyruvate oxidase and decarboxylase Pyr module 0.049
Further Details:      
 
Domain Number 4 Region: 280-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000561
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391008.Smal_0095
Sequence length 1228
Comment (Stenotrophomonas maltophilia R551 3)
Sequence
MTSTAQLTSPSSADLLDRDYTLDHKYTRNEGRIYLSGVQALVRLPLMQRLRDAAEGIDSA
GFVSGYRGSPLGGFDLELWRARKHLDAAKVKFTPGLNEDLGATMVWGTQQTNLFPGANVQ
GVFGMWYGKGPGVDRCGDVFKHANAAGTSRYGGVLALAADDHACRSSTLPHGSEDEFVSA
MMPVLNPAGVQDILDMGLLGWAMSRYTGRWVGFKTIAETVESSASVQVDPMARRIVLPED
FEMPSGGLNIRWPDPPLDQEMRLHRYAVKAAQAFARANGIDKVVMDAPRARLGIVTTGKS
YLDVLQALEYLGLDEAACADIGIRVYKVGMTWPLEPQGIARFAQGLEDIIVVEEKRAFIE
RQMKEQFFNWPASWGQRPSIVGKYDESGEWILPSTGELTPATIAGVIGRRIQKFFNNESI
EQRLQWMQEKEAELALPRASFPRVPHYCSGCPHNTSTQVPEGSRALAGIGCHYMVTWMDR
STDTFTHMGGEGVTWAGQAPFTDTPHVFQNLGDGTYFHSGSLAIRQAVAAGVNITYKILY
NDAVAMTGGQPVDGPLSVPDIAKQMRAEGIHTIVVLSDNIGKWTGQREHFPSDVEFHDRS
ELDAVQKRLREVKGVSILIYEQTCATEKRRRRKRGKLEDPQKRVLINSLVCEGCGDCGKK
SFCVSVLPKETEFGRKREIDQSNCNKDYSCVNGFCPSFVTVHGGQPRKGSKRDASTLLDN
LPAPTIRSTLEQPWNILITGVGGTGVVTIGALLGMAGHLEGKGATVLDQTGLAQKGGAVT
THIRIARRPEDIHAVRIAAGEADLVVGCDMVVVNDYWALSKVRAGRSQVVLNTYEAMPGT
FTTRPDMQFPAADIVAGVRVALGGEEPLLLDATQLATALLGDAIAANLFILGYAWQQGLV
PLSFESLMRAIELNGAAVAMNQQAFAWGRLAVVDPQAVQQAAGLVRNRHTDTETTPGPLH
PLPPGEWEGNEWGATAAPRNTGDERELRGLPSHGGDVAFLPLDDARLSRSLDEMIERRAA
FLVEYQDDAYANRYRSLVERVRAAEADRIGGSTALTETVARYLFKLMAYKDEYEVARLYT
SGDFQRRLQQQFEGDYQLRFHLAPPLFAKKDEQGRLLKKEYGPWMFKAFGLLAKLKFLRG
GRLDVFGRTEERRMERKLIGDYEATVQLLLDGLEDGRLALAVEIASVPEHIRGFGHVKEA
HFEQAKAREAALLAQWRNPKALHIVQVA
Download sequence
Identical sequences B4SRT0
gi|194363873|ref|YP_002026483.1| WP_012509673.1.100705 391008.Smal_0095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]