SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391008.Smal_0226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391008.Smal_0226
Domain Number 1 Region: 389-478
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000053
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391008.Smal_0226
Sequence length 484
Comment (Stenotrophomonas maltophilia R551 3)
Sequence
MQTSYPLRQQWLGNIRGDLLSGIVVALALIPEAIAFSLIAGVDPKVGLYAAFSIAVITAI
AGGRPGMISAATGAMALVMVDLVKDHGLQYLFAASILAGLLQVLAGVFKLGSLMRFVSRS
VITGFVNALAILIFLAQMPELIGRGPTVYVLCAAALAIIYLLPRITRAVPSPLVAIVVLT
AVVIGFGVDVRSVGDMGQLPDSLPHFLLPDVPLTWETLRILLPVSATLAVVGLLESMMTL
QIVEDITETPSERNRECVGQGVANTVTGFLGGMAGCAMIGQSVINVTSGGRGRLSCLVAG
VFLLILVVYGSELVRQIPMAALVAVMIMVSIGTFSWRSLRDLRTHPRSSSAVMLLTVVVT
VATHDLAKGVLSGVLLSALFFARKVGRMLDVQRDDAGDTQVYRVRGQVFFASAGQLGAAF
DYQHVAPKVLIDLRDAHLWDLTAVAALERAQEKLAAHGAEVTVVGLNAASQTLIEQVGGA
RGRH
Download sequence
Identical sequences A0A2J0UK26 B4SSP9
gi|194364004|ref|YP_002026614.1| 391008.Smal_0226 WP_012509771.1.100705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]