SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391009.Tmel_1183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391009.Tmel_1183
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-27
Family Anti-sigma factor antagonist SpoIIaa 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391009.Tmel_1183
Sequence length 112
Comment (Thermosipho melanesiensis BI429)
Sequence
MFNIERKDGIPIVQITGEIDISNAQNFKKFVLDNILNKGEKNCILDFSNMSYIDSSGLGI
LVSLHKSFKINGGEIVLVNLNNNVQNLFRMTSLDKALNLKGSIDEAIKFLKH
Download sequence
Identical sequences A6LM86
391009.Tmel_1183 gi|150021068|ref|YP_001306422.1| WP_012057396.1.25510 WP_012057396.1.29063 WP_012057396.1.34498 WP_012057396.1.43064 WP_012057396.1.53857 WP_012057396.1.82961 WP_012057396.1.85686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]