SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391009.Tmel_1329 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391009.Tmel_1329
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000034
Family NfeD domain-like 0.0043
Further Details:      
 
Weak hits

Sequence:  391009.Tmel_1329
Domain Number - Region: 16-62
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00693
Family Glycerol-3-phosphate transporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391009.Tmel_1329
Sequence length 136
Comment (Thermosipho melanesiensis BI429)
Sequence
MGLILMALEILTPTFFIFWFGVGALASSLVAYFIGNTIWELTVFVVVSGILVILTRPIIN
KMTGDEPRKINVDDIVGKKALVIEEINNKKAKGLVKINGDTWRAFSKNDEIIEKDKYVKV
LKVEGAHLIVIEEGEE
Download sequence
Identical sequences A6LMM7
gi|150021209|ref|YP_001306563.1| 391009.Tmel_1329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]