SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_0646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_0646
Domain Number 1 Region: 231-496
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.26e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.077
Further Details:      
 
Domain Number 2 Region: 13-214
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000000000183
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.03
Further Details:      
 
Domain Number 3 Region: 512-614
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000204
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_0646
Sequence length 615
Comment (Salinispora arenicola CNS-205)
Sequence
MTKKIRQLDRVVIRFAGDSGDGMQLTGDRFTSETAQLGNDISTLPNFPAEIRAPAGTLPG
VSSFQVHFADYDILTPGDSPNVLVAMNPAALKANLADLPRGADIIVNTDEFTRRNLAKVG
YQVNPLEDDSLAGYTLHPVALTSMTVGALAEHAVSKKDAERAKNMFALGLLSWMYSRPYE
STLRFLERKFAARPELVAANVAAFKAGWNFGETTEDFAVRYEIKPARMHPGTYRNITGNM
ALSLGLVAAGVRADLLVFLGAYPITPASDILHELSKHKRFGVLTMQAEDEIAAIGAALGA
SYGGALGVTTTSGPGVALKSETISLAVALELPLVIVDVQRAGPSTGMPTKTEQADLNMAL
YGRHGEAPVAVLAPKSPADCFHAALEAARIALTYRTPVLLLSDNYVANGSEPWLLPEIES
LPDLRVEFATRPNGEDGATFLPYLRDPETLARPWAVPGTPGLEHRIGGLEKADKTGDISY
DPANHDLMVRTRAARIEAIPVPDVEVEDPDGDARVLVLGWGSTYGPIGAACRGLRQRGLA
IAQAHLRHLVPMPANLGEVLRSYERVVIPEMNLGQLAHVIRARYLVDAISYNQVHGLPFT
ANELETMLEEVLKNV
Download sequence
Identical sequences A8M198
391037.Sare_0646 gi|159036306|ref|YP_001535559.1| WP_012180878.1.102098 WP_012180878.1.14007 WP_012180878.1.18430 WP_012180878.1.20048 WP_012180878.1.23841 WP_012180878.1.24936 WP_012180878.1.32557 WP_012180878.1.33355 WP_012180878.1.35493 WP_012180878.1.51738 WP_012180878.1.63836 WP_012180878.1.68706 WP_012180878.1.69805 WP_012180878.1.7007 WP_012180878.1.75797 WP_012180878.1.77205 WP_012180878.1.79888 WP_012180878.1.806 WP_012180878.1.8104 WP_012180878.1.88482 WP_012180878.1.91622 WP_012180878.1.98445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]