SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_2769 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_2769
Domain Number 1 Region: 88-170
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.69e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_2769
Sequence length 178
Comment (Salinispora arenicola CNS-205)
Sequence
MTVLPDDNMMTLICDGCGETAASTAVVLPDEEVVWTLVSEHGWSGSPFATGPHRCPRCVP
SPPGADRPIAAQPSAVNDHDEVVDESAAAVDPLRTALTEATEHEGRVVVDLSAVEQIDSV
GLGLLVRARQEARQRGAELCLHAPSRFVLTVLHTMRLDTAFPIVTAGPDAADQPKVLV
Download sequence
Identical sequences A8M5N6
391037.Sare_2769 WP_012182905.1.102098 WP_012182905.1.10772 WP_012182905.1.14007 WP_012182905.1.18430 WP_012182905.1.20048 WP_012182905.1.23841 WP_012182905.1.24936 WP_012182905.1.2519 WP_012182905.1.25902 WP_012182905.1.26117 WP_012182905.1.28651 WP_012182905.1.29185 WP_012182905.1.29984 WP_012182905.1.30836 WP_012182905.1.32557 WP_012182905.1.33355 WP_012182905.1.35493 WP_012182905.1.3656 WP_012182905.1.37892 WP_012182905.1.45982 WP_012182905.1.51738 WP_012182905.1.58464 WP_012182905.1.63836 WP_012182905.1.68706 WP_012182905.1.69805 WP_012182905.1.7007 WP_012182905.1.76773 WP_012182905.1.806 WP_012182905.1.8104 WP_012182905.1.86246 WP_012182905.1.88482 WP_012182905.1.89801 WP_012182905.1.91622 WP_012182905.1.98430 WP_012182905.1.98445 WP_012182905.1.99814 gi|159038342|ref|YP_001537595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]