SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_3245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_3245
Domain Number 1 Region: 83-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000628
Family NfeD domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_3245
Sequence length 156
Comment (Salinispora arenicola CNS-205)
Sequence
MDAVLWIVVGVVLAIAEIFTTTLFLIMFAVGAFAAAGAAAIGAPVEIQAVVFAVVSALTV
LGARPALRRRITLASTDDSPFGVGAIEGSAALVLERVDVDHGLVKIDGELWQARSYDATQ
VFVPGDRVQVIQVRGATALVWRDDVSPPGELPETKR
Download sequence
Identical sequences A8LV57
WP_012183343.1.102098 WP_012183343.1.10772 WP_012183343.1.14007 WP_012183343.1.18430 WP_012183343.1.20048 WP_012183343.1.23841 WP_012183343.1.23871 WP_012183343.1.24936 WP_012183343.1.2519 WP_012183343.1.25902 WP_012183343.1.28651 WP_012183343.1.29185 WP_012183343.1.29984 WP_012183343.1.30836 WP_012183343.1.32557 WP_012183343.1.33355 WP_012183343.1.35493 WP_012183343.1.3656 WP_012183343.1.37892 WP_012183343.1.45982 WP_012183343.1.51738 WP_012183343.1.58464 WP_012183343.1.61781 WP_012183343.1.63836 WP_012183343.1.68706 WP_012183343.1.69805 WP_012183343.1.7007 WP_012183343.1.75797 WP_012183343.1.76231 WP_012183343.1.76773 WP_012183343.1.77205 WP_012183343.1.79888 WP_012183343.1.806 WP_012183343.1.81166 WP_012183343.1.83049 WP_012183343.1.86246 WP_012183343.1.88482 WP_012183343.1.89801 WP_012183343.1.91622 WP_012183343.1.98430 WP_012183343.1.98445 WP_012183343.1.99814 391037.Sare_3245 gi|159038787|ref|YP_001538040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]