SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391037.Sare_4521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391037.Sare_4521
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391037.Sare_4521
Sequence length 111
Comment (Salinispora arenicola CNS-205)
Sequence
MDRAELSITLHRLGDEVVLRLAGEIDMLTASQLSTVVNEVLTDPPPRIVLDLAAVTFCDS
QGLGTLVVLSRKASHSQSLLVLTNVAEFLLRVLDITGLRSALMIRNESPTP
Download sequence
Identical sequences A8M6S6
391037.Sare_4521 WP_012184520.1.23841 WP_012184520.1.24936 WP_012184520.1.28651 WP_012184520.1.29185 WP_012184520.1.35493 WP_012184520.1.37892 WP_012184520.1.45982 WP_012184520.1.68706 WP_012184520.1.69805 WP_012184520.1.75797 WP_012184520.1.79888 WP_012184520.1.806 WP_012184520.1.8104 WP_012184520.1.88482 WP_012184520.1.91622 WP_012184520.1.98445 gi|159040031|ref|YP_001539284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]