SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_0205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  391038.Bphy_0205
Domain Number - Region: 15-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000589
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 
Domain Number - Region: 208-263
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.012
Family DmpA-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_0205
Sequence length 379
Comment (Burkholderia phymatum STM815)
Sequence
MNYDTPPGLEVTAGGQGKIVRLSGQWTALALARDRLHGQALPRLRELVDSRAHVAQWDLS
NVERMDHVGGQALWRVWGYKLPRDLVALNDTQRDIFDRIALLDTVRENPEPVRRFDPFTQ
LGLGIFSFVEHVYGGVAMFGRVILDLLSIARNPKLAPWKEISANVYSAGTQALPITALVA
FLIGIVLSYLSAQQLRLFGANQFIVNILGMSVLRELGPVLSAILVAGRSGSAITAQIGVM
RVTEELDAMRVMGIPHGLRLILPRVIALSLAMPLLVMWTNIISLLGGALAAKLVLQIDVS
YFVRALPGVVPVANLWIGLGKGMVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVSSIT
IVILADAVFAILFQNVGLS
Download sequence
Identical sequences B2JKK9
391038.Bphy_0205 gi|186474974|ref|YP_001856444.1| WP_012399627.1.55900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]