SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_3162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_3162
Domain Number 1 Region: 237-283
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000224
Family AraC type transcriptional activator 0.048
Further Details:      
 
Domain Number 2 Region: 186-235
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000278
Family AraC type transcriptional activator 0.027
Further Details:      
 
Weak hits

Sequence:  391038.Bphy_3162
Domain Number - Region: 64-168
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.000902
Family Regulatory protein AraC 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_3162
Sequence length 285
Comment (Burkholderia phymatum STM815)
Sequence
MNANHPAWVPHSGARESLLSSASLGWSGFGAELLGISAGTHCLPAFAEHRVGVHVGAPVR
AVCRCDGQRAARIQAHGDADVVPAGVDGEWSDDASCTVLRIWFADDFVRTTVDQLGPRSA
HAHIRPQLQLRDARVQHLAWAMRAELEAEHACDPLYAESLCTAMIVRLAGAAPAGDGKRR
TLSSRAAARVIDYIDAHLDGRLTLTELAALVELSVPHFKVLFRETMGVPLHRYVVQRRVE
RARELLLQGRSNASQVALEAGFAHQSHMAHWMKRLLGVTPRELLR
Download sequence
Identical sequences B2JRK3
391038.Bphy_3162 gi|186472034|ref|YP_001859376.1| WP_012402503.1.55900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]