SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_4678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_4678
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily GlnB-like 1.39e-19
Family DUF190/COG1993 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_4678
Sequence length 123
Comment (Burkholderia phymatum STM815)
Sequence
MLLTRQRISSVGRSAMQGSQLTVFAATTGPRKHHQTTVDWILEAARQAGIHGATVVEVSE
CVDLRGKYHAARFVELADQPVAITLAGESARVDALLDCLRQGDVPLFYTRCAVEYEVLGS
GVP
Download sequence
Identical sequences B2JRC2
gi|186473492|ref|YP_001860834.1| 391038.Bphy_4678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]