SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_5012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_5012
Domain Number 1 Region: 460-569
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.44e-16
Family Anti-sigma factor antagonist SpoIIaa 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_5012
Sequence length 579
Comment (Burkholderia phymatum STM815)
Sequence
MQSDHPVPEDGQVAVKPPAWMRWLPGLTLLKGYRASWLPNDLAAGLVLTTMLVPVGIAYA
EASGVPGVYGLYATIIPLLAYALFGPSRILVLGPDSALAAPILAVVVAIAGRDPSRAVAV
ASMMAIVSGLFCIVMGLLRLGFITELLSKPIRYGYMNGIALTVLISQLPKLFAISFDDRG
PLRDLLTLGAALVAGKANWYSFAVGAGSLVLILLLKRFDKVPGILIAVILATLSVTVFDL
DSLGVKVLGKIPQGLPSFALPWAGDADFVKIVLGGCAVALISFADTSVLSRTFAARFHTR
VDPNQEMVGLGAANLAAGFFQGFPISSSSSRTPVAEAAGARTQVTGIVGAVAVAILLMAA
PNLMRYLPNSALAAVVIAAAIGLFEFADLKRIYRIQQWEFWLSVVCFAGVAVFGAIPGIC
IAVALAVIEFLWDGWRPHFAVLGRVEGLRGYHDITRYPHAARIPGLLLFRWDAPLFFANA
ELFQQRLLEAVDESPSSINRVVVAAEPVTSVDVTSADMLRELNRLLDERGIALHFAEMKD
PVRDKLRRFELFDIIGDERFHPTVGSAVDDYLGRTDSAQ
Download sequence
Identical sequences B2JLD4
WP_012404266.1.55900 391038.Bphy_5012 gi|186473806|ref|YP_001861148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]