SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_5124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_5124
Domain Number 1 Region: 33-139,177-235
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.52e-27
Family Clp protease, ClpP subunit 0.041
Further Details:      
 
Domain Number 2 Region: 457-497
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000432
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_5124
Sequence length 508
Comment (Burkholderia phymatum STM815)
Sequence
MRLHRALLLALTVCCAAAFAPCARAAQPAVVPGSVVVIPIAGAISPATADFIVRGLARAA
EDHAQLAVLQLDTPGGLDTSMRQIIKAILASPVPVATYIAPGGARAASAGTYITYASHIA
AMAPGTNLGAASPVQLGIGGQDAPRPSQPAALPGAAPSSSPSSNPAVKDNAASGALALDS
QSTELRKQLHDAQAYIRGLAQLRGRNVEWAERAVREAVSLSARDALEQKVVDIVARDLPD
LLRQLDGRTYDTAAGAQHLTTAHAPVVTLEADWRNHFLAVITDPNVALILLMIGMYGLFF
EFANPGFVLPGVAGAISLLLGLFALQLLPVNYVGLSLIFLGLAFLIAEAFLPTFGALGFG
GIVAFAIGALMLIDTDVPGYGIPLPMIAAVVVFSVLFIFGVSSLVLRSRRRPVVTGAEAM
IGSFGVVLDDGLVAVDSDAMESRPEVRADSLLHGEPERVGWARVHGERWRVCSNAPLAAG
NAVRVTGRRGLMLTVVPANPAPSQGERT
Download sequence
Identical sequences B2JLY3
391038.Bphy_5124 gi|186473915|ref|YP_001861257.1| WP_012404375.1.55900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]