SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391038.Bphy_5599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391038.Bphy_5599
Domain Number 1 Region: 184-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.63e-70
Family D-glucarate dehydratase-like 0.0000000844
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.66e-39
Family Enolase N-terminal domain-like 0.00000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391038.Bphy_5599
Sequence length 432
Comment (Burkholderia phymatum STM815)
Sequence
MTTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSATYVTLETDSPRELVGHGLTFTIGRGN
EICVAAVNALAPLIVGKKLEDIAADMGAFWRSFTSDSQLRWIGPDKGAIHLATAAVVNAV
WDLWAKSAGKAVWKLLVDMSPEELVRCLDFRYVTDAITPYEALAMLHRHARTKGEREKEM
LAKGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVGGNLEEDVRRARILREEIG
ENLKLMMDANQVWDVDEAVANMRRLAEFDPWWIEEPTSPDDILGHAAIRERLGSIGVATG
EHCHNRVMFKQLLQAQAIDFCQVDSCRLGGLNEVIVVLLMAAKFGVPVCPHAGGVGLCEY
VQHISLFDYICVSASLENRVLEYVDHLHEHFVDPVVIRHGRYMPPQKPGYSIEMKADSLN
MHVYPEGEAWQP
Download sequence
Identical sequences B2JUF2
391038.Bphy_5599 WP_012404834.1.55900 gi|186470402|ref|YP_001861720.1| gi|186470402|ref|YP_001861720.1|NC_010625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]