SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391165.GbCGDNIH1_1452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391165.GbCGDNIH1_1452
Domain Number 1 Region: 35-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000412
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391165.GbCGDNIH1_1452
Sequence length 392
Comment (Granulobacter bethesdensis CGDNIH1)
Sequence
MHHGCGSSPLTIMGIDQTSASILSPAWTMASEGMVATLSLSGEWTVASGGLNTRPINAFP
VGTERLLIDVSALQRWDSALISFLWSLEQRCNTSGITLDNSTLPHSARGLLALLPEHPHP
SAPAPAKHFAPVQAIGASTLSMLTECGTVTELGVETLRGAGATLFGGHGMRWRDLLRDIS
DAGPSALLIVGIVNFLMGSILAFVGAVQLRKFAADIYVANLVGLASVREMSAVMTAIIMA
GRTGGAYAARIATMTGNEEIDALRVFGIPVSRYLLLPSIAALVLTMPILYLYACLISLVG
GYIVSQGMLDVTMAGFWNHLFGSVHIDQFVFGFVKTITFAMLIGLVSCRIGLKAGRSAAD
VGVAATRAVVSGIVGVIALDSMFAVLATIIGI
Download sequence
Identical sequences Q0BS52
gi|114328116|ref|YP_745273.1| 391165.GbCGDNIH1_1452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]