SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391295.SSU05_0451 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  391295.SSU05_0451
Domain Number - Region: 64-130
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0981
Family Anti-sigma factor antagonist SpoIIaa 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391295.SSU05_0451
Sequence length 299
Comment (Streptococcus suis 05ZYH33)
Sequence
MQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGNMEVGLLIGASLQLVVLG
VGTFGGASRIDATSGAVLATAFSISQGLDPEIAISTIGVPVAGLLVYTDILGRFTTTFFA
HRVDAAIERFDYAGIERNYLLGAIPWALSRALPVFLALAFGGGLVETLVTTIELPEYKWI
AAGLTLAARMLPGLGFAILLHYLPLKRNLHYLAVGFALTAMLTVLYGNVSALGGAVAGIV
GTLPEDAGVSFVNNFKGLSMIGIAIVGAFLSVIHFKNSQKVTVVAPSNSESGEIEDDEI
Download sequence
Identical sequences A0A0H3MTJ5 A0A0Z9BQL5 A4VTH8 D5AGA1 G7SKU0 U5UGS0
gi|476419387|ref|YP_007570383.1| gi|389856133|ref|YP_006358376.1| gi|386577403|ref|YP_006073808.1| WP_011922010.1.10007 WP_011922010.1.100280 WP_011922010.1.100404 WP_011922010.1.100670 WP_011922010.1.100701 WP_011922010.1.100908 WP_011922010.1.101097 WP_011922010.1.101179 WP_011922010.1.101295 WP_011922010.1.101447 WP_011922010.1.101621 WP_011922010.1.101658 WP_011922010.1.101706 WP_011922010.1.101901 WP_011922010.1.102038 WP_011922010.1.10265 WP_011922010.1.1035 WP_011922010.1.10700 WP_011922010.1.10896 WP_011922010.1.11017 WP_011922010.1.11330 WP_011922010.1.11527 WP_011922010.1.11548 WP_011922010.1.11662 WP_011922010.1.11869 WP_011922010.1.11874 WP_011922010.1.11918 WP_011922010.1.1200 WP_011922010.1.12022 WP_011922010.1.12228 WP_011922010.1.12288 WP_011922010.1.1244 WP_011922010.1.12606 WP_011922010.1.12665 WP_011922010.1.12803 WP_011922010.1.13051 WP_011922010.1.13095 WP_011922010.1.1324 WP_011922010.1.13380 WP_011922010.1.13633 WP_011922010.1.13861 WP_011922010.1.1405 WP_011922010.1.14202 WP_011922010.1.14210 WP_011922010.1.1424 WP_011922010.1.1434 WP_011922010.1.14359 WP_011922010.1.1495 WP_011922010.1.15112 WP_011922010.1.1537 WP_011922010.1.15393 WP_011922010.1.15545 WP_011922010.1.15756 WP_011922010.1.15813 WP_011922010.1.1616 WP_011922010.1.16193 WP_011922010.1.1629 WP_011922010.1.16498 WP_011922010.1.16643 WP_011922010.1.16677 WP_011922010.1.16683 WP_011922010.1.16773 WP_011922010.1.16829 WP_011922010.1.16881 WP_011922010.1.17264 WP_011922010.1.17388 WP_011922010.1.17670 WP_011922010.1.17749 WP_011922010.1.17814 WP_011922010.1.17824 WP_011922010.1.17958 WP_011922010.1.17989 WP_011922010.1.18271 WP_011922010.1.18341 WP_011922010.1.18403 WP_011922010.1.18563 WP_011922010.1.18711 WP_011922010.1.18850 WP_011922010.1.19145 WP_011922010.1.19352 WP_011922010.1.19378 WP_011922010.1.19521 WP_011922010.1.1953 WP_011922010.1.19865 WP_011922010.1.19898 WP_011922010.1.20400 WP_011922010.1.20518 WP_011922010.1.20584 WP_011922010.1.20756 WP_011922010.1.20819 WP_011922010.1.20944 WP_011922010.1.21072 WP_011922010.1.21347 WP_011922010.1.21348 WP_011922010.1.21374 WP_011922010.1.21457 WP_011922010.1.21903 WP_011922010.1.21994 WP_011922010.1.22785 WP_011922010.1.22848 WP_011922010.1.22882 WP_011922010.1.23089 WP_011922010.1.23273 WP_011922010.1.23317 WP_011922010.1.23358 WP_011922010.1.23682 WP_011922010.1.23965 WP_011922010.1.24078 WP_011922010.1.24150 WP_011922010.1.24175 WP_011922010.1.24187 WP_011922010.1.24431 WP_011922010.1.24858 WP_011922010.1.24883 WP_011922010.1.25245 WP_011922010.1.25280 WP_011922010.1.25381 WP_011922010.1.25396 WP_011922010.1.25617 WP_011922010.1.25711 WP_011922010.1.25798 WP_011922010.1.25824 WP_011922010.1.25841 WP_011922010.1.25950 WP_011922010.1.26009 WP_011922010.1.26302 WP_011922010.1.26324 WP_011922010.1.26368 WP_011922010.1.26507 WP_011922010.1.26620 WP_011922010.1.27108 WP_011922010.1.27225 WP_011922010.1.27227 WP_011922010.1.27381 WP_011922010.1.27476 WP_011922010.1.27695 WP_011922010.1.27754 WP_011922010.1.27760 WP_011922010.1.27767 WP_011922010.1.28000 WP_011922010.1.28033 WP_011922010.1.28099 WP_011922010.1.28244 WP_011922010.1.28467 WP_011922010.1.28645 WP_011922010.1.28796 WP_011922010.1.28805 WP_011922010.1.28908 WP_011922010.1.29141 WP_011922010.1.29299 WP_011922010.1.29542 WP_011922010.1.29545 WP_011922010.1.29610 WP_011922010.1.29635 WP_011922010.1.30079 WP_011922010.1.30136 WP_011922010.1.30241 WP_011922010.1.30344 WP_011922010.1.30414 WP_011922010.1.30785 WP_011922010.1.31418 WP_011922010.1.31425 WP_011922010.1.31597 WP_011922010.1.31707 WP_011922010.1.31730 WP_011922010.1.31763 WP_011922010.1.32048 WP_011922010.1.32259 WP_011922010.1.32292 WP_011922010.1.32332 WP_011922010.1.32380 WP_011922010.1.32466 WP_011922010.1.32630 WP_011922010.1.32947 WP_011922010.1.33330 WP_011922010.1.33471 WP_011922010.1.33494 WP_011922010.1.33623 WP_011922010.1.34321 WP_011922010.1.34425 WP_011922010.1.34527 WP_011922010.1.34652 WP_011922010.1.34738 WP_011922010.1.35430 WP_011922010.1.35551 WP_011922010.1.35675 WP_011922010.1.35725 WP_011922010.1.36136 WP_011922010.1.36180 WP_011922010.1.36251 WP_011922010.1.36341 WP_011922010.1.36437 WP_011922010.1.36611 WP_011922010.1.36766 WP_011922010.1.36945 WP_011922010.1.37126 WP_011922010.1.37237 WP_011922010.1.376 WP_011922010.1.37653 WP_011922010.1.37688 WP_011922010.1.37816 WP_011922010.1.37841 WP_011922010.1.37914 WP_011922010.1.37915 WP_011922010.1.38409 WP_011922010.1.38470 WP_011922010.1.39011 WP_011922010.1.39023 WP_011922010.1.39247 WP_011922010.1.39280 WP_011922010.1.39714 WP_011922010.1.3989 WP_011922010.1.40062 WP_011922010.1.40141 WP_011922010.1.40228 WP_011922010.1.40265 WP_011922010.1.40384 WP_011922010.1.40507 WP_011922010.1.40669 WP_011922010.1.4074 WP_011922010.1.40802 WP_011922010.1.41046 WP_011922010.1.41112 WP_011922010.1.41280 WP_011922010.1.41340 WP_011922010.1.41854 WP_011922010.1.42323 WP_011922010.1.42552 WP_011922010.1.42596 WP_011922010.1.42732 WP_011922010.1.42735 WP_011922010.1.4278 WP_011922010.1.42784 WP_011922010.1.42827 WP_011922010.1.42840 WP_011922010.1.4291 WP_011922010.1.43264 WP_011922010.1.43288 WP_011922010.1.43482 WP_011922010.1.43813 WP_011922010.1.43922 WP_011922010.1.43963 WP_011922010.1.43977 WP_011922010.1.44047 WP_011922010.1.44128 WP_011922010.1.44134 WP_011922010.1.44592 WP_011922010.1.44676 WP_011922010.1.44778 WP_011922010.1.45088 WP_011922010.1.45216 WP_011922010.1.45219 WP_011922010.1.45278 WP_011922010.1.45345 WP_011922010.1.45864 WP_011922010.1.45936 WP_011922010.1.467 WP_011922010.1.46880 WP_011922010.1.47108 WP_011922010.1.47119 WP_011922010.1.47315 WP_011922010.1.47375 WP_011922010.1.47434 WP_011922010.1.4748 WP_011922010.1.4757 WP_011922010.1.47643 WP_011922010.1.47745 WP_011922010.1.47894 WP_011922010.1.47900 WP_011922010.1.48167 WP_011922010.1.48217 WP_011922010.1.48397 WP_011922010.1.48583 WP_011922010.1.48603 WP_011922010.1.48616 WP_011922010.1.49093 WP_011922010.1.49099 WP_011922010.1.49206 WP_011922010.1.49255 WP_011922010.1.49368 WP_011922010.1.49413 WP_011922010.1.49509 WP_011922010.1.49782 WP_011922010.1.49968 WP_011922010.1.50047 WP_011922010.1.5021 WP_011922010.1.50437 WP_011922010.1.50538 WP_011922010.1.50551 WP_011922010.1.50675 WP_011922010.1.50751 WP_011922010.1.5079 WP_011922010.1.50798 WP_011922010.1.51052 WP_011922010.1.51263 WP_011922010.1.51386 WP_011922010.1.51551 WP_011922010.1.52159 WP_011922010.1.52175 WP_011922010.1.52490 WP_011922010.1.52599 WP_011922010.1.52628 WP_011922010.1.52798 WP_011922010.1.53174 WP_011922010.1.53290 WP_011922010.1.53309 WP_011922010.1.534 WP_011922010.1.53448 WP_011922010.1.53487 WP_011922010.1.53749 WP_011922010.1.53805 WP_011922010.1.53918 WP_011922010.1.54000 WP_011922010.1.5404 WP_011922010.1.54184 WP_011922010.1.54384 WP_011922010.1.54488 WP_011922010.1.54535 WP_011922010.1.54683 WP_011922010.1.54800 WP_011922010.1.54828 WP_011922010.1.55064 WP_011922010.1.55137 WP_011922010.1.55158 WP_011922010.1.55649 WP_011922010.1.55687 WP_011922010.1.5579 WP_011922010.1.55815 WP_011922010.1.55833 WP_011922010.1.55834 WP_011922010.1.55975 WP_011922010.1.56140 WP_011922010.1.56150 WP_011922010.1.56215 WP_011922010.1.56434 WP_011922010.1.56463 WP_011922010.1.57067 WP_011922010.1.5714 WP_011922010.1.57164 WP_011922010.1.57189 WP_011922010.1.5754 WP_011922010.1.57640 WP_011922010.1.57674 WP_011922010.1.57810 WP_011922010.1.58229 WP_011922010.1.58517 WP_011922010.1.58566 WP_011922010.1.58585 WP_011922010.1.58706 WP_011922010.1.58746 WP_011922010.1.58793 WP_011922010.1.58815 WP_011922010.1.58903 WP_011922010.1.58933 WP_011922010.1.5894 WP_011922010.1.59071 WP_011922010.1.59138 WP_011922010.1.59144 WP_011922010.1.59283 WP_011922010.1.59349 WP_011922010.1.5936 WP_011922010.1.59524 WP_011922010.1.59647 WP_011922010.1.5974 WP_011922010.1.59929 WP_011922010.1.60233 WP_011922010.1.60237 WP_011922010.1.60293 WP_011922010.1.60377 WP_011922010.1.60445 WP_011922010.1.60658 WP_011922010.1.60659 WP_011922010.1.60853 WP_011922010.1.609 WP_011922010.1.61370 WP_011922010.1.61415 WP_011922010.1.61533 WP_011922010.1.61540 WP_011922010.1.6156 WP_011922010.1.6165 WP_011922010.1.61715 WP_011922010.1.61721 WP_011922010.1.61782 WP_011922010.1.61885 WP_011922010.1.6223 WP_011922010.1.62268 WP_011922010.1.62485 WP_011922010.1.62497 WP_011922010.1.62587 WP_011922010.1.62710 WP_011922010.1.6272 WP_011922010.1.6278 WP_011922010.1.62805 WP_011922010.1.63018 WP_011922010.1.63174 WP_011922010.1.63318 WP_011922010.1.63653 WP_011922010.1.63685 WP_011922010.1.6377 WP_011922010.1.63959 WP_011922010.1.64120 WP_011922010.1.64128 WP_011922010.1.64273 WP_011922010.1.64281 WP_011922010.1.64384 WP_011922010.1.64641 WP_011922010.1.64797 WP_011922010.1.64952 WP_011922010.1.65024 WP_011922010.1.65047 WP_011922010.1.65174 WP_011922010.1.65314 WP_011922010.1.65422 WP_011922010.1.65458 WP_011922010.1.65905 WP_011922010.1.65911 WP_011922010.1.65917 WP_011922010.1.6596 WP_011922010.1.66185 WP_011922010.1.66472 WP_011922010.1.66590 WP_011922010.1.66609 WP_011922010.1.66707 WP_011922010.1.6686 WP_011922010.1.6690 WP_011922010.1.66954 WP_011922010.1.67058 WP_011922010.1.67109 WP_011922010.1.6711 WP_011922010.1.67256 WP_011922010.1.67338 WP_011922010.1.67488 WP_011922010.1.677 WP_011922010.1.67883 WP_011922010.1.67897 WP_011922010.1.67958 WP_011922010.1.67962 WP_011922010.1.68010 WP_011922010.1.68602 WP_011922010.1.68666 WP_011922010.1.68739 WP_011922010.1.68791 WP_011922010.1.68941 WP_011922010.1.69056 WP_011922010.1.69115 WP_011922010.1.69161 WP_011922010.1.69413 WP_011922010.1.69454 WP_011922010.1.69698 WP_011922010.1.69706 WP_011922010.1.69806 WP_011922010.1.69922 WP_011922010.1.70033 WP_011922010.1.70387 WP_011922010.1.70403 WP_011922010.1.70484 WP_011922010.1.70817 WP_011922010.1.70997 WP_011922010.1.71125 WP_011922010.1.71140 WP_011922010.1.71336 WP_011922010.1.71425 WP_011922010.1.71498 WP_011922010.1.71727 WP_011922010.1.718 WP_011922010.1.71914 WP_011922010.1.72174 WP_011922010.1.72247 WP_011922010.1.72296 WP_011922010.1.72413 WP_011922010.1.7257 WP_011922010.1.72611 WP_011922010.1.73011 WP_011922010.1.73262 WP_011922010.1.73280 WP_011922010.1.73299 WP_011922010.1.7342 WP_011922010.1.73679 WP_011922010.1.73721 WP_011922010.1.73905 WP_011922010.1.74090 WP_011922010.1.74567 WP_011922010.1.74800 WP_011922010.1.74843 WP_011922010.1.74865 WP_011922010.1.75022 WP_011922010.1.75028 WP_011922010.1.75605 WP_011922010.1.75930 WP_011922010.1.75965 WP_011922010.1.75985 WP_011922010.1.76083 WP_011922010.1.76175 WP_011922010.1.76400 WP_011922010.1.76666 WP_011922010.1.76735 WP_011922010.1.76907 WP_011922010.1.77006 WP_011922010.1.77616 WP_011922010.1.77624 WP_011922010.1.77781 WP_011922010.1.77795 WP_011922010.1.77958 WP_011922010.1.78138 WP_011922010.1.78326 WP_011922010.1.78456 WP_011922010.1.7873 WP_011922010.1.78744 WP_011922010.1.78792 WP_011922010.1.7889 WP_011922010.1.78945 WP_011922010.1.79054 WP_011922010.1.79154 WP_011922010.1.79162 WP_011922010.1.79499 WP_011922010.1.79644 WP_011922010.1.79679 WP_011922010.1.80097 WP_011922010.1.80131 WP_011922010.1.80153 WP_011922010.1.80169 WP_011922010.1.80216 WP_011922010.1.80235 WP_011922010.1.80418 WP_011922010.1.8061 WP_011922010.1.80716 WP_011922010.1.80742 WP_011922010.1.8083 WP_011922010.1.81103 WP_011922010.1.81370 WP_011922010.1.81513 WP_011922010.1.81584 WP_011922010.1.81705 WP_011922010.1.82122 WP_011922010.1.8251 WP_011922010.1.82830 WP_011922010.1.82870 WP_011922010.1.82977 WP_011922010.1.8344 WP_011922010.1.83818 WP_011922010.1.83915 WP_011922010.1.84389 WP_011922010.1.84412 WP_011922010.1.84489 WP_011922010.1.8451 WP_011922010.1.85051 WP_011922010.1.85075 WP_011922010.1.8514 WP_011922010.1.85327 WP_011922010.1.85333 WP_011922010.1.85437 WP_011922010.1.85450 WP_011922010.1.85908 WP_011922010.1.86151 WP_011922010.1.86817 WP_011922010.1.86836 WP_011922010.1.86842 WP_011922010.1.87044 WP_011922010.1.87321 WP_011922010.1.87344 WP_011922010.1.87438 WP_011922010.1.87450 WP_011922010.1.87819 WP_011922010.1.87874 WP_011922010.1.87885 WP_011922010.1.8790 WP_011922010.1.88201 WP_011922010.1.88543 WP_011922010.1.88575 WP_011922010.1.88635 WP_011922010.1.88653 WP_011922010.1.88746 WP_011922010.1.88779 WP_011922010.1.88882 WP_011922010.1.88972 WP_011922010.1.89037 WP_011922010.1.89038 WP_011922010.1.89056 WP_011922010.1.89128 WP_011922010.1.89156 WP_011922010.1.89279 WP_011922010.1.89358 WP_011922010.1.89388 WP_011922010.1.89800 WP_011922010.1.8993 WP_011922010.1.89989 WP_011922010.1.90172 WP_011922010.1.90419 WP_011922010.1.90961 WP_011922010.1.91238 WP_011922010.1.91387 WP_011922010.1.91636 WP_011922010.1.91865 WP_011922010.1.91912 WP_011922010.1.91973 WP_011922010.1.91983 WP_011922010.1.92134 WP_011922010.1.92263 WP_011922010.1.92441 WP_011922010.1.92554 WP_011922010.1.92692 WP_011922010.1.92722 WP_011922010.1.928 WP_011922010.1.92964 WP_011922010.1.93190 WP_011922010.1.93220 WP_011922010.1.93456 WP_011922010.1.93519 WP_011922010.1.9361 WP_011922010.1.93627 WP_011922010.1.93646 WP_011922010.1.9376 WP_011922010.1.93771 WP_011922010.1.94332 WP_011922010.1.94338 WP_011922010.1.94418 WP_011922010.1.94419 WP_011922010.1.94449 WP_011922010.1.9454 WP_011922010.1.94639 WP_011922010.1.94786 WP_011922010.1.94945 WP_011922010.1.95180 WP_011922010.1.95213 WP_011922010.1.95214 WP_011922010.1.95262 WP_011922010.1.95288 WP_011922010.1.95351 WP_011922010.1.95542 WP_011922010.1.95798 WP_011922010.1.96164 WP_011922010.1.96282 WP_011922010.1.96427 WP_011922010.1.96451 WP_011922010.1.9652 WP_011922010.1.96524 WP_011922010.1.96574 WP_011922010.1.96700 WP_011922010.1.97052 WP_011922010.1.97453 WP_011922010.1.97493 WP_011922010.1.97504 WP_011922010.1.97515 WP_011922010.1.97554 WP_011922010.1.97857 WP_011922010.1.9809 WP_011922010.1.9815 WP_011922010.1.98253 WP_011922010.1.98271 WP_011922010.1.98326 WP_011922010.1.98343 WP_011922010.1.98406 WP_011922010.1.98416 WP_011922010.1.98860 WP_011922010.1.98864 WP_011922010.1.98921 WP_011922010.1.99127 WP_011922010.1.9922 WP_011922010.1.99252 WP_011922010.1.99324 WP_011922010.1.99696 WP_011922010.1.99988 YP_003028159.1.79686 218494.SSU0404 391295.SSU05_0451 391296.SSU98_0439 568813.SSUSC84_0389 568814.SSUBM407_0392 gi|253753196|ref|YP_003026336.1| gi|556588032|ref|YP_008755586.1| gi|146320286|ref|YP_001199997.1| gi|403061089|ref|YP_006649305.1| gi|386581449|ref|YP_006077853.1| gi|253751295|ref|YP_003024436.1| gi|386587680|ref|YP_006084081.1| gi|253755019|ref|YP_003028159.1| gi|386579385|ref|YP_006075790.1| gi|146318105|ref|YP_001197817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]