SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_1966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_1966
Domain Number 1 Region: 13-215
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000196
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_1966
Sequence length 510
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MSQLSTLKPHSIHIAIMALGGQGGGVLVDWIVRLAEHAGWTAQATSVAGVAQRTGATIYY
IELVEPTPGQAPVLALMAVPGDVDVLIAAELMEAGRAVERGLVTPGRTTVIASSHRVFAI
QEKMVSGNGIADSAQVLDIVRREARHLVMADMQALAAGQGSVISASLFGALAGSGALPFA
LAEFEAVVERSGVGVKPSLAALRAGAAVARSAAPPDPPADPMHTAPRPLPATAASAQLQP
LLERIRAAFPRPAWDWLGEGLARVVDYQDAAYGGEYLDHVARLLAADPDADAADGQVAIE
AARWVAVAMSYDDVIRVADLKTRAERSARLRREVAAGADDVVGSEEYFHPRMEEVMGLLP
RRLADWLDGSPRLRDWLASRLSRGRRIRTHTLRGHLQLHLVAGLRRWRRSSRRHAEELGH
LQAWLAEVQQVLPHDRALALELLRCRRLVKGYSDTHARGSSRFDRLLRAARELRGRADAG
PALGALREAALRDAEGQALSQRLQTLGLAP
Download sequence
Identical sequences A1WJB1
WP_011809724.1.29080 gi|121608929|ref|YP_996736.1| 391735.Veis_1966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]