SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_2402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_2402
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000133
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_2402
Sequence length 89
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MLALPPELTQRQATACLRLLLQGLKAQPERAVRVDAKALTRFDSTALAVLLECRRAALSE
GRGFAVQDLPLALAGMARLYGVDGLLTGG
Download sequence
Identical sequences A1WKJ1
gi|121609359|ref|YP_997166.1| 391735.Veis_2402 WP_011810151.1.29080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]