SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_2909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_2909
Domain Number 1 Region: 106-377
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.17e-76
Family D-glucarate dehydratase-like 0.0000478
Further Details:      
 
Domain Number 2 Region: 1-120
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.01e-26
Family Enolase N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_2909
Sequence length 415
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MKIISMKSHVVAVPPPYIGGMYWIFVTLKTACGIEGVGEIYASTFHPKVVACAMDDVFER
HLLDHDPHHIERFFRAAYSSGFTQRPDLTMMGIVSGLEMACWDIIGKAAGKPVYELIGGR
VHERLRTYTYLYPKNAKGEHDYDDVDLSVACAVDLVKQGFTAVKFDPAGPYSVYSGHHLS
LEVMDKSEEFCKKIREAVGSKCDLLFGTHGQMTVASAVRLARRLEKYDPLWFEEPVPPGQ
VDAMAAVAGKTSIPIATGERLTTKYEFFDLLQRGGASILQMNLGRVGGILEAKKIAGIAE
VHCAQIAPHLYNGPVGAAASVQLATATPNFLIQESIMTWQGFHAEILKQPIQWEDGFIIP
SREPGLGVELNMDVVEANAPYVGSRLHITMDPQPFDVKQPSSDSWKKRWSDEVAR
Download sequence
Identical sequences A1WLY8
WP_011810641.1.29080 gi|121609856|ref|YP_997663.1| 391735.Veis_2909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]