SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_4499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_4499
Domain Number 1 Region: 94-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.37e-61
Family D-glucarate dehydratase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.39e-23
Family Enolase N-terminal domain-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_4499
Sequence length 367
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MKINRLETFSNRHVGFVRVTTDTGLQGWGQMSTYNADITAQVFHRQIAPWALGANALDIE
HLVNIIPEREHKFPCSYLFRALAGLDTALWDLRGKLEQKSVCELLGGQPRAFPVYASSMK
RDITPENEAARLSRLRDAHGFGAFKFRVGKECGHDQDEWPGRTEAIVPTMRRALGDGARL
LVDGNSCYTPAKAIAVGRMLEEHGVVHFEEPCPYWEHRWTKEVKESLKLDVTGGEQDCDL
TLWQYAIDQRVVDIVQPDVFYIGGVTRMLKVARMAEQAGLKVTPHSANHSLVTLVTLHIM
GALKNAGDYVEYSIEGADYYPWEQGLFRNYLNVKDGKVQIPSEPGWGLEICPQWLEKSRH
AVSEVQA
Download sequence
Identical sequences A1WRE2
391735.Veis_4499 WP_011812183.1.29080 gi|121611410|ref|YP_999217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]