SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391735.Veis_4654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391735.Veis_4654
Domain Number 1 Region: 142-380
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.08e-42
Family D-glucarate dehydratase-like 0.000000608
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.06e-23
Family Enolase N-terminal domain-like 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 391735.Veis_4654
Sequence length 389
Comment (Verminephrobacter eiseniae EF01-2)
Sequence
MRIVDIREISVPLKGNVSNALVNFSEHTVSLVAVFSDVVRNGKPVVGVAFNSIGRFAQHG
LLHERFIPRILKCTPESLLESDGRTFSAKAIFRAAMTNEKPGGHGDRATAVAALELAIWD
LNAKLADEPAYVTIARAAGRPAQTRAKPVYAAGGYYYPEDSSNRLRSELQAYRDLGFVDF
KIKIGGASLEEDLKRIHMALEISEGGEHLAVDANGRFDLQTALAYADAIAPLALRWYEEV
GDPLDFRLNAEIASRYRGAIATGENLFSTIDTVNLMRFGGMRPGLDVFQMEAGLSYGLTE
YMATLKELEAHGFSREQVQPHGGHLINLHIATGLGLGGCEVYPGVFQPFGGYSAACMVSE
GYAMPTQAPGFGLEEKPGLSEAIAELIKR
Download sequence
Identical sequences A1WRU4
391735.Veis_4654 NYSGXRC-9456d WP_011812334.1.29080 gi|121611562|ref|YP_999369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]