SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 391774.Dvul_1536 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391774.Dvul_1536
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily GlnB-like 2.22e-31
Family DUF190/COG1993 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391774.Dvul_1536
Sequence length 114
Comment (Desulfovibrio vulgaris DP4)
Sequence
MPAPSGTATRLRIYFAEDDMHEGRALHTVIIEKAMQAKLAGATMQRALAGFGANSTLHTA
RVLHLAESLPLVIEIIDSAERIEAFMPEVEAILEEGLVTLEPVEVRLYRHRPKA
Download sequence
Identical sequences A0A0E0T2P9 A0A0H3A8H5 Q72BN7
gi|46580009|ref|YP_010817.1| WP_010938889.1.14085 WP_010938889.1.63145 YP_010817.1.77684 gi|120602580|ref|YP_966980.1| 391774.Dvul_1536 882.DVU1598 gi|387153548|ref|YP_005702484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]