SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391774.Dvul_2559 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391774.Dvul_2559
Domain Number 1 Region: 15-209
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-34
Family Pyruvate oxidase and decarboxylase Pyr module 0.034
Further Details:      
 
Domain Number 2 Region: 638-831
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.14e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 286-538
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.2e-23
Family Pyruvate oxidase and decarboxylase PP module 0.027
Further Details:      
 
Domain Number 4 Region: 547-645
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000934
Family Ferredoxin domains from multidomain proteins 0.035
Further Details:      
 
Domain Number 5 Region: 239-305
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000707
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391774.Dvul_2559
Sequence length 832
Comment (Desulfovibrio vulgaris DP4)
Sequence
MNAIKQLCTQNAGEAAVLQGNIAFAAGCVRSGIHAVDGYPGTPSTEVIDKGLSNVQDMIK
VGWSVSEAVAVSMGHGHSLAGEDCIVTMKIPGLFQAGDPFSSSAFFTEDRGALVYYLASD
FTPSSTQHLVDPRPFIRSCFTPIFEPRNHQEMHEAAEIAADISRQYKTPVVILASGTLCH
SEGLVRLSEIRTRERVVSSVPLKAFNTLPVTARRNYDKVVTERMPALADMVEKSPLNVWE
RGSRKVGVITFGVGEMMVREVKQALGEDIDILSLGFTCPLPMNLIREFHASIEGDVYVVE
DGYRYLQEELERAGLAVKGKSPADTVTEWDPAGIAALLGYSLKSPAASDVAPLPRAPMIC
AGCPYRLFGETVRSMKKRGKIEACFGDIGCNTLLYFMDAMDTNVAMGAGEAHRAGFIVAN
PDKAAKCISLLGDGTECHSGMDATRNTIFRHIAGVKVVLDNNWTAMTGGQPGPTSPVNLA
GQENTFDLQASLKAHGAKVVVVNGYDRKGIRTALTSALEDAANGEFTTMVVTGVCIRKMP
KSAYGTRMTVDADLCKRCGQCQICPGISADAEGLPSFNNLCSGCVSQNAACGQMCPVHAI
KAAEAVDTRATARVELPQAPEQIVMPAPGSFTLPEKIAVAIRGVGGQGNLFFGRVLTQLA
FLAGYGDTNVVKGETHGMAQMGGPVISTFSCGKAVSPVLLPGTADCLVSMEMSEVLRPGY
VGMLRPGGTVLLADTRVLPYGVSEDAYPHRDAILGTLDGYNVIIIDVLKAALELGDPTGR
IANVVMIGALSTLAPFDGFPAELWLQALRNVSPKPAIWTANHAAFNVGRGLL
Download sequence
Identical sequences A0A0H3AB67
gi|120603602|ref|YP_968002.1| WP_011792924.1.63145 391774.Dvul_2559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]