SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391774.Dvul_2983 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391774.Dvul_2983
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-27
Family Anti-sigma factor antagonist SpoIIaa 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 391774.Dvul_2983
Sequence length 111
Comment (Desulfovibrio vulgaris DP4)
Sequence
MQIVTTERDGITVISLTGRMDATTVASFDEAWRTCLDNGARRIVVDLGGVEYISSAGLRG
ILSLLKASKAAKGGLAFCNVGQMVAEVFRISGFTSMLAVFPGLDEALASLA
Download sequence
Identical sequences A0A0E0T711 A0A0H3ACE1 Q72WG6
gi|120586837|ref|YP_961182.1|NC_008741 gi|387134014|ref|YP_005704004.1|NC_017311 gi|46562138|ref|YP_009163.1|NC_005863 gi|120586837|ref|YP_961182.1| 391774.Dvul_2983 882.DVUA0123 gi|387134014|ref|YP_005704004.1| gi|46562138|ref|YP_009163.1| WP_011176701.1.14085 WP_011176701.1.63145 YP_009163.1.77684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]