SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391896.A1I_03875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  391896.A1I_03875
Domain Number - Region: 84-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00314
Family NfeD domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391896.A1I_03875
Sequence length 152
Comment (Rickettsia bellii OSU 85-389)
Sequence
MINEYLTEIWLIIGVICIIAEFFAIPNIGFLFFGFGALLNALIIYNYPLISLTNQITLFG
LISLIWFCILYYPLKKYVYSKTTTNENYSDMIGKEAEVYSDVISEENLGQVKWSGVIMNA
YLAPNEKAKSGDKVFITKVKGNILICSKHRPK
Download sequence
Identical sequences A0A0F3QHV1
391896.A1I_03875 gi|157827101|ref|YP_001496165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]