SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 391904.Blon_0667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  391904.Blon_0667
Domain Number 1 Region: 97-398
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.9e-66
Family D-glucarate dehydratase-like 0.00039
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.41e-29
Family Enolase N-terminal domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 391904.Blon_0667
Sequence length 415
Comment (Bifidobacterium longum infantis ATCC 15697)
Sequence
MAIEKAEVFVTSPGRNFVVFRITTTDGVVGLGDATLNGRELVAAKYLETIAPSLIGKNED
NIEDIWQYLYKGAYWKRGPVTMAAISAVDVALWDIKAKKAGVPVYELLGGASRTGILTYA
HASGVDFPSLFDSIDMYRDMGFKATRIQFALPGIPSTYGVAGSANSQQGAGEKGLRYDYE
PARRTTVPVEEVWDARTYLNTLPGVFEEVRNKYGKDLILLHDSHHRLSPIQAARFGKSLE
PYDLFWMEDSTPAEENQEFLRIVREHTTTPIAIGEIINSWSDYITLIKEQLIDYVRSAVT
HTGGLTHMKKLMAFAELFGVKSGFHGPTDVSPVGMAANLHLDLAIPNFGIQEYMKHSEET
LEVFHTSYTFKDGYLHPGNKPGLGVDFDEKLAAKYPYQPAPLPVDRLLDGTMHEW
Download sequence
Identical sequences A0A1S2VZI0 B7GPP3
391904.Blon_0667 gi|213691565|ref|YP_002322151.1| gi|213691565|ref|YP_002322151.1| WP_012577064.1.101695 WP_012577064.1.11785 WP_012577064.1.12559 WP_012577064.1.29604 WP_012577064.1.30595 WP_012577064.1.36470 WP_012577064.1.38041 WP_012577064.1.40778 WP_012577064.1.40827 WP_012577064.1.48267 WP_012577064.1.59461 WP_012577064.1.69278 WP_012577064.1.70852 WP_012577064.1.71991 WP_012577064.1.80607 WP_012577064.1.8081 WP_012577064.1.86319 WP_012577064.1.91730 WP_012577064.1.99918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]