SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392499.Swit_1237 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392499.Swit_1237
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.77e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 392499.Swit_1237
Sequence length 112
Comment (Sphingomonas wittichii RW1)
Sequence
MIWSEEARDGAIVAAPRGKIDESTAQDFGASLEGAVARAADAAARLVVDCSGIDYMSSRG
LRALTLAKRKADGSAVTILLAAPNGVVREILAISRYDKLFGVTETVEAALTA
Download sequence
Identical sequences A5V5N6
392499.Swit_1237 gi|148554158|ref|YP_001261740.1| WP_011952080.1.21155 WP_011952080.1.69875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]