SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392499.Swit_3236 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392499.Swit_3236
Domain Number 1 Region: 207-484
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.1e-57
Family PFOR Pyr module 0.0094
Further Details:      
 
Domain Number 2 Region: 13-191
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 
Domain Number 3 Region: 503-600
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000089
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392499.Swit_3236
Sequence length 615
Comment (Sphingomonas wittichii RW1)
Sequence
MTRPITAVNDFVVKFANVNGSGSASANGLFVKAILRMGVPVGARNIFPSNIQGLPTWYEI
RVSGHGWLGRRGGVDLMVAMNPQTWDRDVAEIEPGGYLFYDSTKPMPSSKFRDDITVVGL
PLTALCNAAYAEPSKRKILKNIIYLGALTFLLGIERAVVEALLAEEYAAKPALIPANIEA
LQIGFDHARDHLKPLGLKLRRADAVGDRIFVDGNTAAGLGAVYGGATVCAWYPITPSTSL
AEAFTAYCRKLRHDPETGPDGGGARYAIVQAEDEIASIGMVTGAGWNGARAFTCTSGPGV
SLMQEFIGLSYFAEIPGVIFDVQRGGPSTGMPTRTQQSDILSAAYASHGDTKHVLLLPEG
PNECFEFGALAFDLADRLQTMIFVMLDLDMGMNEWLIEPFRWDEDRVLDRGKIMTAEMLE
AGADFGRYKDVDGDGIPWRTLPATHPSKGSYFTRGTSRDPYARYSEEGAVYVDNMERLLR
KFETAKSLVPPPIVRRAARKTSYGVIYYGSTSPAMDEALAGLEADGVAVDALRVRAFPFE
GEIFEFIAAHDLVFVVEQNRDAQLRTLLINEGGVDPARLVKVLNYDGSPITARFIQAELA
KGMGVPKARAGEMVR
Download sequence
Identical sequences A5VBB6
392499.Swit_3236 gi|148556138|ref|YP_001263720.1| WP_012049426.1.69875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]