SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392499.Swit_5156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  392499.Swit_5156
Domain Number - Region: 97-168
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0942
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 392499.Swit_5156
Sequence length 219
Comment (Sphingomonas wittichii RW1)
Sequence
MGLKDRDYMRERYRARAKGTRWNDRAGRVEGAWFDPVNRGFDYQRGRLRGSRGNAGGMLR
WMSLALSLFLIAIPVWHSLKREGWLADSEPGLPFPETGSVTVNPALDPAGATSRMAVTTS
DANAVVQLFDPQSGRHVISVYVRKNDRAIIAVPPGTYRMKVAEGQRWHGPVDFFGSSTTY
DAVVPLMVFTRQRGNGIDLHRRPNGTLPTRPNWRGPAPL
Download sequence
Identical sequences A0A160TML8 A0A249MZH0 A5VG51
392499.Swit_5156 gi|148550595|ref|YP_001260034.1|NC_009507 WP_011950426.1.22621 WP_011950426.1.69875 gi|148550595|ref|YP_001260034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]