SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_0719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392500.Swoo_0719
Domain Number 1 Region: 17-215
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.93e-44
Family Voltage-gated potassium channels 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_0719
Sequence length 270
Comment (Shewanella woodyi ATCC 51908)
Sequence
MAERKKWLPQTEEELTPFQLAMMALSLLSVIVVLVLSFAKLEPETKRLLTAVDFSICIIF
LTYFFYGLARADDKVYYIKHNWIDFVASIPVIEPLRFARLFQILRVIRLIRMAQSFIVPM
VKQRRQATLASLLVAMVTILTFSSVLILIVESGVPDANIQTAENAIWWALVTISTVGYGD
YYPVTTAGHVIGGIVIICGVSFFGVISGYMASLFIAPDESEKIEAQSKEIRTELHDALER
MEANQGMLLKQIDELQQELKQERSSSGKSS
Download sequence
Identical sequences B1KE28
392500.Swoo_0719 WP_012323361.1.29706 WP_012323361.1.77901 gi|170725083|ref|YP_001759109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]