SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_3258 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392500.Swoo_3258
Domain Number 1 Region: 131-330
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.03e-46
Family D-glucarate dehydratase-like 0.00000716
Further Details:      
 
Domain Number 2 Region: 20-118
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.93e-21
Family Enolase N-terminal domain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_3258
Sequence length 355
Comment (Shewanella woodyi ATCC 51908)
Sequence
MIDSTKRLHFYGEDFELIAIQQSIPLKQVFRIARGAKNAAQVIVVIIKYQGVIGWGESVP
YARYGETIEGIISSIKTVCTHAKRFTDFANAISAHSQGAAQNALDCAYLDLQAKLTGIAT
QARFNLPKTRAVITAQTLSIDTPEAMAEAAKPLAKAPLIKVKLDNIDIVEKMTAIYAMAP
HSQFIVDANEAWSIEDLKLCADKLAALNVVLIEQPLPAEKDEALASLTINIALCADESCH
TVKDLSALSGKYDVVNIKLDKTGGLNQAVALAAQAKEMGFDIMLGCMVGSSLAMAPAFLL
TPFAKYIDLDGPLLVKEDRLVSFDIDNGLMQPFNEQLWGGVDLESNIEADQLIKL
Download sequence
Identical sequences B1KNS0
gi|170727597|ref|YP_001761623.1| 392500.Swoo_3258 WP_012325864.1.77901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]