SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 392500.Swoo_3582 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  392500.Swoo_3582
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.4e-34
Family Chaperone J-domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 133-210
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 9.29e-24
Family DnaJ/Hsp40 cysteine-rich domain 0.000016
Further Details:      
 
Domain Number 3 Region: 258-343
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.83e-21
Family HSP40/DnaJ peptide-binding domain 0.0015
Further Details:      
 
Domain Number 4 Region: 117-151,212-255
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.75e-19
Family HSP40/DnaJ peptide-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 392500.Swoo_3582
Sequence length 378
Comment (Shewanella woodyi ATCC 51908)
Sequence
MSKRDYYEVLSVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAETSFKEVKEAYEILTDS
DKKAAYDQFGHAGVDPNRGGGGFGGNADFGDVFGDVFGDIFGGGRRGGGQRQAARGSDLR
YNLELSLEEAVKGLTKELRIPTLAHCDTCDGSGAKKGTSPTTCGTCHGQGQVQMRQGFFA
VQQACPTCHGRGKIIKDPCNSCHGEGRVEKSKTLSVKIPAGVDNGDRIRLSGEGEAGEFG
APPGDLYVQVSVREHAIFVRDGNNLYCEVPISFGKAALGGEIEVPTLDGKVNLKIPAETQ
TGRMFRMRGKGVKSVRSHAVGDLLCKVVMETPVKLNERQKELLREFDETLAGSSSKKHSP
KAEGFFDGVKKFFQDLNS
Download sequence
Identical sequences B1KRT1
gi|170727915|ref|YP_001761941.1| WP_012326179.1.29706 WP_012326179.1.77901 392500.Swoo_3582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]