SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393011.FTH_1454 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393011.FTH_1454
Domain Number 1 Region: 409-502
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 393011.FTH_1454
Sequence length 514
Comment (Francisella tularensis holarctica OSU18)
Sequence
MLNYKESFIGRNIKSDVLSGFVVAVALIPEAIGFSFIAGVSPTVGLYTAFILGLVTALIG
GKPGMISGATGAVAVVLVSLGIKVKASLSPEMLNSLTQSGELSSYILQYILLCVIMAGVI
QVIIGILRLGKLIRLVPQPAMYGFVNGLVIVIALAQIPLFKGEGIAMYVLVGVTMLIVYF
LPKFTDKVPSGLVAIIVITAVVVFFKLQTKNVGDLADIFGAFPSFALPNIHLTMQSFLIV
LPYAMIVALVGLIESLLTLSVLDEMDNKHGNGNEECIAQGTGNIVCGFFGGMAGCTMIGQ
SIINFTNGGRGRLSSLTAALLLISFVVALSGYISYIPVAVLAGIMFMVCINTFECESVNR
IRYMPNSDKVVLVAVTVITVFSDLAIAVISGVIISALVFAWKSSQVHSRTHREDDNTKVY
EFFGPLFFGSTSSFKSLFDVNYDPENVILDFANSRVMDISGAEAIDDITKKYLDLGKKVT
LKHLSEDCRKILKNAGPYCIFEEIDPTYKLVRDV
Download sequence
Identical sequences WP_011648750.1.28031 WP_011648750.1.64987 gi|115315180|ref|YP_763903.1| 393011.FTH_1454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]