SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393115.FTF0709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393115.FTF0709
Domain Number 1 Region: 140-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.98e-129
Family Enolase 0.0000000209
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-54
Family Enolase N-terminal domain-like 0.00000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 393115.FTF0709
Sequence length 456
Comment (Francisella tularensis FSC 198)
Sequence
MSSQIKQVFARQILDSRGNPTIEVEVVLESGAFGRAAVPSGASTGIREALELRDGNKALF
LGKSVYKAVENVNTKIAQAVKGLDALDQRLIDKTMIELDGSENKKNLGANAILGVSLATA
RAAASHLRKPFYRYLMDVKEYLMPVPMMNVINGGSHADNNVDMQEFMIVPAGFDTFSEAL
RCGTEVFHILKKVLIADGYSVAGVGDEGGYAPDLPSNEAAIEAILKAVKEAGYEPGKHVF
IALDPASSEFYKDGKYELKSENKSLTSEEMIDYYAAWVEKYPIVSIEDGLAEEDWAGWKL
LTEKLGNKVQLVGDDLFVTNPSILAKGIEKGIANSILIKLNQIGTLTETFEAMAMAGQAG
YTCVVSHRSGETSDTIIADLAVATCSGQIKTGSLSRSDRIAKYNQLLRIEEELGENAIYP
GIKAFVFNSDEEVEEVVQEIIVEDSEAEKVVVQVEE
Download sequence
Identical sequences A0A0E3A3J8 A0A0M1U5B8 Q14IC0 Q5NGW8
gi|110670299|ref|YP_666856.1| IDP02814 gi|56707828|ref|YP_169724.1| gi|379725680|ref|YP_005317866.1| WP_003020514.1.101979 WP_003020514.1.10388 WP_003020514.1.11695 WP_003020514.1.1833 WP_003020514.1.19035 WP_003020514.1.2301 WP_003020514.1.25812 WP_003020514.1.31410 WP_003020514.1.35965 WP_003020514.1.36081 WP_003020514.1.3831 WP_003020514.1.38368 WP_003020514.1.38474 WP_003020514.1.38662 WP_003020514.1.40634 WP_003020514.1.44744 WP_003020514.1.52816 WP_003020514.1.56738 WP_003020514.1.5829 WP_003020514.1.59625 WP_003020514.1.60146 WP_003020514.1.61154 WP_003020514.1.65967 WP_003020514.1.66077 WP_003020514.1.66092 WP_003020514.1.67317 WP_003020514.1.75261 WP_003020514.1.77053 WP_003020514.1.80616 WP_003020514.1.82545 WP_003020514.1.87851 WP_003020514.1.98147 YP_169724.1.84429 gi|385794469|ref|YP_005830875.1| gi|379717076|ref|YP_005305412.1| 177416.FTT_0709 393115.FTF0709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]