SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393305.YE2102 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393305.YE2102
Domain Number 1 Region: 794-1164
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.11e-117
Family PFOR PP module 0.0000000362
Further Details:      
 
Domain Number 2 Region: 417-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.94e-74
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000104
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.03e-72
Family PFOR Pyr module 0.0000000907
Further Details:      
 
Domain Number 4 Region: 255-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.57e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000258
Further Details:      
 
Domain Number 5 Region: 665-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.33e-22
Family Ferredoxin domains from multidomain proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 393305.YE2102
Sequence length 1177
Comment (Yersinia enterocolitica 8081)
Sequence
MITTDGNSAVASVAYRASEVIAIYPITPSSTMAEQADAWSGDGKVNIWGDVPRVVEMQSE
GGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTIATHALSIF
GDHSDVMAVRQTGCAMLCASSVQEAQDFALISQVATLNSRIPFIHFFDGFRTSHEINKIV
PLSDDTLRQLLPQKGIDGHRSRALSPDHPVVRGTSANPDTYFQSREATNPWYNNTYQHVA
DAMQAFAEATGREYKPFEYYGHPQAERVIILMGSAIGTCEEVIDSLLTRGEKVGVLKVRL
FRPFSAEHLLSVLPQSVTKIAVLDRTKEPGALAEPLYLDVMTALAEAYSRGERATLPKVI
GGRYGLSSKEFGPDCALAVFKELSLDLPRPRFTVGIFDDVTGLSLPLTDEKIEQRATLEA
LFYGLGSDGSVSATKNNIKIIGNSTSLYAQGYFVYDSKKAGGLTVSHLRVSETPINSAYL
VSQADFVGCHQLQFIDTYQMAERLKPGGIFLINTPFSADEMWQRLPQEVQAVLHQRNARL
FVINAAKIARECKLGARINTVMQMAFFHLTQILPTAMAQEQLRAAIDRSYSNKGPEIVTR
NWQALDATLDALVEIPLQLIDENSPMRPPIVSDQAPDFVKTVTATMLAGLGDALPVSAFP
PDGTWPVGTTQWEKRNIAEDIPIWQPDLCTQCNHCVAACPHSAIRAKVVQPDAMSGAPDS
LQSLEVKARDMRGQKYVLQVAPEDCTGCNLCYEVCPAKDRQNPEIKAINMKPRLEHLLEE
KAHYDFFLKLPEIDKTQMERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLYGDRLL
IANATGCSSIYGGNLPTTPYTTNADGRGPAWANSLFEDNAEFGLGFRLTVDQHRQRVIRL
INQLAAQLPQELVNQLLNEEATLEVRREQVTQLRQLLKDIPGNDAQQLATDADYLVDKSI
WLIGGDGWAYDIGFGGLDHVLSLTENVNVLVLDTQCYSNTGGQQSKATPLGAVTKFGEHG
KRKARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYD
LAYSHDQMKQLTATGFWPLYRFDPRRTDEGKVALALDSRPPNSDLTTTLLNEQRFRRLNT
QEPEVAAQLYAAAEKDLKKRYDFLSLLAGKTEKAPTE
Download sequence
Identical sequences A1JNA8
393305.YE2102 WP_011816353.1.51324 YP_001006344.1.77335 gi|123442365|ref|YP_001006344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]