SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393305.YE3059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393305.YE3059
Domain Number 1 Region: 89-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000942
Family NfeD domain-like 0.0061
Further Details:      
 
Weak hits

Sequence:  393305.YE3059
Domain Number - Region: 27-86
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00209
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 393305.YE3059
Sequence length 149
Comment (Yersinia enterocolitica 8081)
Sequence
MLEEIAANPNWFWLSLGGLLLAAEMLGASGYMLWSGVAAVVVGILVWLFPFSWEMQGVLF
AVLTVVSAILWWYWLSKRIKPQPAMLNQRNHQLLGTRATLTEPTVDGYGRMKVGDSSWRI
YSANELSVGTEVEVILVEGNTLHVRAVHH
Download sequence
Identical sequences A0A0T9S3H6 A0A0T9UHU7 A1JN93
WP_005167770.1.100034 WP_005167770.1.22156 WP_005167770.1.23750 WP_005167770.1.28488 WP_005167770.1.29173 WP_005167770.1.35647 WP_005167770.1.39120 WP_005167770.1.39701 WP_005167770.1.47151 WP_005167770.1.51324 WP_005167770.1.53745 WP_005167770.1.62658 WP_005167770.1.69335 WP_005167770.1.7032 WP_005167770.1.75090 WP_005167770.1.78943 WP_005167770.1.80986 WP_005167770.1.85569 WP_005167770.1.91311 WP_005167770.1.95393 WP_005167770.1.98085 YP_001007242.1.77335 gi|123443268|ref|YP_001007242.1| 393305.YE3059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]