SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393305.YE4043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393305.YE4043
Domain Number 1 Region: 164-411
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-76
Family D-glucarate dehydratase-like 0.00000000377
Further Details:      
 
Domain Number 2 Region: 1-159
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.16e-58
Family Enolase N-terminal domain-like 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 393305.YE4043
Sequence length 414
Comment (Yersinia enterocolitica 8081)
Sequence
MKIKHALFTAGNSSFYFDDQQAIKNGAKLDGFIYQGKPVTEGFSAIRQAGECVNVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFIAANFVPFLEKHIKPLLEGRDISEFRLNASFFDEVT
IDGKPLHTAIRYGLSQALLDATALATGRLKAEVVCDEWHLPLVAKPIPLFGQSGDDRYIA
VDKMILKGVDVLPHGLINNVDEKLGRNGEKLRDYVSWLAKRVSDLRVDPSYKPDLHIDVY
GTIGLIFDMDPILCAEYIASLQEQAGELNLYIEGPVDAGNKPDQIRLLTEITHHLKKLGS
NVKIVADEWCNTYQDIIDFTDAGSCHMVQIKTPDLGSIHNIVDAVLYCNKKGMEAYQGGT
CNETDISARTCVHVALASRPMRMLIKPGMGFDEGMNIVFNEMTRTIAQLNAKAN
Download sequence
Identical sequences A0A2J9S5E1 A1JSN8
gi|123444217|ref|YP_001008185.1| WP_011817376.1.23750 WP_011817376.1.39120 WP_011817376.1.51324 WP_011817376.1.85569 WP_011817376.1.91311 YP_001008185.1.77335 393305.YE4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]