SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393595.ABO_0097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393595.ABO_0097
Domain Number 1 Region: 81-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000458
Family NfeD domain-like 0.0081
Further Details:      
 
Weak hits

Sequence:  393595.ABO_0097
Domain Number - Region: 5-69
Classification Level Classification E-value
Superfamily Photosystem II antenna protein-like 0.0214
Family Photosystem II antenna protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 393595.ABO_0097
Sequence length 157
Comment (Alcanivorax borkumensis SK2)
Sequence
MDLPEYSYWIIAGLALVIAEFAISGLVVIFFGIAALLVGSLKFIGLLDDTTWELTVFAIT
SLLSLVFVRRVLNDKLMGREQQREGEEDSAGLIGHRATVAEAFAKGTGTVNYRGARWQAQ
CSHPLNPGDIVRITQHEGLWLTVEPWPVISPQDTQKN
Download sequence
Identical sequences Q0VTJ8
gi|110832958|ref|YP_691817.1| 393595.ABO_0097 WP_011587395.1.14994 WP_011587395.1.41240 WP_011587395.1.66393 WP_011587395.1.75482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]