SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 393595.ABO_1123 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393595.ABO_1123
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily GlnB-like 1.05e-44
Family Prokaryotic signal transducing protein 0.00000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 393595.ABO_1123
Sequence length 112
Comment (Alcanivorax borkumensis SK2)
Sequence
MKMLTAVVKPFKADQVRDALAQVGVQGMTITEVKGFGRQKGHTELYRGAEYVVDFVPKVK
LELAVSDEQLDQAIDVIMKAAGTGKIGDGKIFVTDLEQVIRIRTGEIGSEAI
Download sequence
Identical sequences Q0VQH7
393595.ABO_1123 WP_011588406.1.14994 WP_011588406.1.41240 WP_011588406.1.75482 gi|110833984|ref|YP_692843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]