SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 393595.ABO_1943 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  393595.ABO_1943
Domain Number 1 Region: 455-564
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000182
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 393595.ABO_1943
Sequence length 590
Comment (Alcanivorax borkumensis SK2)
Sequence
MRLPGWLAASQWLPLYNRQTAAQDGVAAVVVTIMLIPQSLAYAMLAGLPPQVGLYASILP
LVAYALFGSSRTLAVGPVAVASLMTAAAASEIAAAGTPEYIASTIILAALSGAILILMAL
FKLGWIANLLSHPVVSGFITASGILIAASQLKHLLGVPLSGRNLYELGASLYHHLPDIHL
PTLILGGTATVFLFWVRRSFKPLLLKMGLTPFWADLISKAGPVLAVLATTLLAASLRLDQ
QGVDIVGDIPSGLPGFIMPAMDTELWRQLLVPALLISLIGFVESISVAQTLAAKRRQRIN
PDQELMGLGTANLASAFSGGFPVTGGFSRSVVNFDAGAQTPMAGVFTAVGIALTALLLTG
LFVFLPKATLAATIVVAVLSLVDLATLKHTWHFSRLDFTAMIITIVGVLGWGVEAGVMAG
VISSLALYLWRTNQPHVAEIGLVPGTEHFRNVQRHAVKVSPRIMSMRIDESLYFANIRRL
EDQIYDAALQRPQTEHVVLMGTAINHLDASAIDGLLSLNRRLADAGITLHFSEIKGPVMD
QFKRAALPEQLSGKIYLTHYQAMQDLAPECIKQQDRQDEEDLQPPHTPVS
Download sequence
Identical sequences Q0VN57
WP_011589222.1.14994 393595.ABO_1943 gi|110834804|ref|YP_693663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]