SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394.NGR_b11300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394.NGR_b11300
Domain Number 1 Region: 16-133,160-211
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.53e-24
Family Clp protease, ClpP subunit 0.058
Further Details:      
 
Domain Number 2 Region: 387-450
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000183
Family NfeD domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 394.NGR_b11300
Sequence length 455
Comment (Rhizobium NGR234)
Sequence
MSRILTLVLFLLSAFALPISSVSAAERVALVLHVNGAISPATAEYVIRGLQRAEDRGVAL
VVLQMDTPGGLDTSMRDIIRAILDSSVPVASFVAPSGARAASAGTYILYASHVAAMAPGT
NLGAATPIAIGGGLFGGDDESEKEKPADQGKPDVPKPPSSAGEAKLINDAVAYIRGLAEL
RNRNADWAEKAVREAASLSSPAAVREKVVDFTAVSIEDLLKQAHGRTVRIGQTDSRLDTT
GLAAEDLLPDWRTRLLSVITDPNVALLLMVVGIYGLIFEFLTPGTVVPGTIGGICLLLGL
YALAVLPVSYAGIGLIILGVALLVGEAHAPSFGVLGLGGGVAIVLGAAILFDTDVPGLQV
SWPVLAGVAIASFAFSLIVARLAFVSRRHKVATGAEQMIGILGKVDTWTGAGGYVIAHGE
RWRAVSGEPLGPGEDVMVIGRDGLTLEVERRAKRS
Download sequence
Identical sequences C3KR75
gi|227819365|ref|YP_002823336.1|NC_012586 394.NGR_b11300 YP_002823336.1.63916 gi|227819365|ref|YP_002823336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]