SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394.NGR_b14290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394.NGR_b14290
Domain Number 1 Region: 115-388
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.34e-67
Family D-glucarate dehydratase-like 0.00054
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.51e-34
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 394.NGR_b14290
Sequence length 390
Comment (Rhizobium NGR234)
Sequence
MKITGLETFCLAYQMPYPLTYPRGEYQSREAVLVKVHTDDPDIFGWGEAAMWGGPWATTT
TVLEQQIQPLIVGHDPRRPEYLWEKVYQETYYHGRKGILLSCLSAVDIALWDILGKATGE
PVWRLLGGFARPLRAYASSGYYRRDYSINDLAEDVAKARSTGYRGYKMKVGNIASAVHAG
VLDETPHRVSIARDLARVRAARDALGGDLDLMCDATTSLDARTAMTYADEFERIGVRWFE
EPTQPENIAGCAELARRTRIPIAGFETETNKFNFAAMMDAGAIQMVQPDVIQVGGITEAR
KIAAYAQMRHLGFSSKNYSTAVSLAACLNLLYALPNADYFECDMDPSPWREEFLRAPLFT
FDGGMVEPFERPGLGLDIDEAALSAWRVSQ
Download sequence
Identical sequences C3KKE4
394.NGR_b14290 gi|227819662|ref|YP_002823633.1|NC_012586 gi|227819662|ref|YP_002823633.1| YP_002823633.1.63916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]