SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394.NGR_c28610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  394.NGR_c28610
Domain Number - Region: 93-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00262
Family NfeD domain-like 0.0089
Further Details:      
 
Domain Number - Region: 38-105
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 0.00445
Family Homocysteine S-methyltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 394.NGR_c28610
Sequence length 155
Comment (Rhizobium NGR234)
Sequence
MIQRFAIELGPWSWWVLGLALLAAEVMLPGVFLVWIGLAALITGGLSLLLWETAFWVWEV
QVVVFALLSIASVFIGRRFVVSSSKSDEPLLNKRGESLVGRTAVLEQPIAEGRGRVRLDD
TTWVVEGPDLPAGTRVRIVASSGRQLTVERAEASL
Download sequence
Identical sequences C3MIP4
YP_002827360.1.63916 gi|227823387|ref|YP_002827360.1| 394.NGR_c28610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]