SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 394221.Mmar10_1620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  394221.Mmar10_1620
Domain Number 1 Region: 457-568
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 394221.Mmar10_1620
Sequence length 582
Comment (Maricaulis maris MCS10)
Sequence
MAWLRRLLPGLEWLDGYDGHRLTQDGLASLVTAILLIPQSLAYALLAGLPPQAGLYASIA
PLVAYALFGSSRVLAVGPVAVISLMTAAAIGSLGLTDPADLMAAAGALALLSSVFLLLFG
VFRLGSVANFLSRPVVEAFITASTVLIIASQLRHFLGVEMEGATIPELVVSLIRQFDGIN
TTALAMGVISLAFLLASRSLLPNLLERTGLATSHISILTRIAPAALVALTALTAWAFGLQ
ERTGLSIVGELPSGLPPFAFPIVPLETWRALIGPAALISLVGFVESVSVGQSLAARRRET
INPNRELLGLGAANAAAAFTGGYPVTGGFARSVVNESAGAETPVAGVFTALIILLVAAFL
TPLFHHLPKAALAATILAAIWRMANFHDAWLAWKYSHADGAAAFLTLVGVLFLGVEIGLT
LGVALSVGLVLQRTMRPHWAEVGQVPRTHHFRNINRHEVICSPHVVSLRIDEALYFANAR
FLEDLAGEIIARESRPTDLVLLFAAVNFVDASALGSLRVINARLGDAGVKLHLSEVKGPV
ADKLLEAGFYEELSGEVFLSHYAAMRTLDPATTLRAEGVSPD
Download sequence
Identical sequences A0A2D5JUP7 Q0AP75
394221.Mmar10_1620 WP_011643559.1.83773 gi|114570170|ref|YP_756850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]